2.50 Rating by CuteStat

gridphilly.com is 1 decade 6 years old. It is a domain having com extension. It has a global traffic rank of #1528851 in the world. This website is estimated worth of $ 720.00 and have a daily income of around $ 3.00. As no active threats were reported recently by users, gridphilly.com is SAFE to browse.

PageSpeed Score
0
Siteadvisor Rating
No Risk Issues

Traffic Report

Daily Unique Visitors: 551
Daily Pageviews: 1,102

Estimated Valuation

Income Per Day: $ 3.00
Estimated Worth: $ 720.00

Search Engine Indexes

Google Indexed Pages: 7,920
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: 9,350
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: No Risk Issues
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: 1,528,851
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

198.185.159.144

Hosted Country:

United States of America US

Location Latitude:

37.751

Location Longitude:

-97.822

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 21 H2 Headings: 3
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 74
Google Adsense: Not Applicable Google Analytics: UA-92767195-1

Websites Hosted on Same IP (i.e. 198.185.159.144)

Payless ShoeSource

- payless.com

PAYLESS IS STILL HERE! You can still get your favorite Payless styles on Amazon in the United States. More shoes are arriving every week from Champion®, SafeTStep, SmartFit®, Spotlights, and more!

204,180 $ 43,740.00

Jawbone

- jawbone.com
513,552 $ 2,400.00

Dinar Recaps

- dinarrecaps.com

Dinar Recaps has all the best Iraqi Dinar stories and rumors from all the major Dinar Forums in one place. Quick, easy and consolidated, all on "Our Blog" page online. Subscribe to our free daily email newsletter to get all our new posts sent to you.

109,489 $ 109,800.00

xtranormal

- xtranormal.com

movies made by you

Not Applicable $ 8.95

LE WEB

- leweb.net
7,494,868 $ 240.00

HTTP Header Analysis

HTTP/1.1 200 OK
date: Thu, 12 Dec 2019 20:50:22 GMT
strict-transport-security: max-age=0
expires: Thu, 01 Jan 1970 00:00:00 GMT
content-type: text/html;charset=utf-8
etag: W/"2195caf3cfdbc609bf422bba1ffb4167--gzip"
content-encoding: gzip
Vary: Accept-Encoding
Age: 17986
Accept-Ranges: bytes
Content-Length: 38129
x-contextid: xcz0e9jn/rk612Pb7
server: Squarespace

Domain Information

Domain Registrar: acens Technologies, S.L.U.
Registration Date: Feb 29, 2008, 11:04 PM 1 decade 6 years 1 month ago
Expiration Date: Feb 28, 2020, 11:04 PM 4 years 1 month 3 weeks ago
Domain Status:
clienttransferprohibited
clientupdateprohibited
clientrenewprohibited
clientdeleteprohibited

Domain Nameserver Information

Host IP Address Country
ns51.domaincontrol.com 97.74.105.26 United States of America United States of America
ns52.domaincontrol.com 173.201.73.26 United States of America United States of America

DNS Record Analysis

Host Type TTL Extra
gridphilly.com A 600 IP: 198.185.159.144
gridphilly.com NS 3600 Target: ns51.domaincontrol.com
gridphilly.com NS 3600 Target: ns52.domaincontrol.com
gridphilly.com SOA 3600 MNAME: ns51.domaincontrol.com
RNAME: dns.jomax.net
Serial: 2016050400
Refresh: 28800
Retry: 7200
Expire: 604800
Minimum TTL: 3600
gridphilly.com MX 3600 Priority: 30
Target: aspmx2.googlemail.com
gridphilly.com MX 3600 Priority: 30
Target: aspmx3.googlemail.com
gridphilly.com MX 3600 Priority: 10
Target: aspmx.l.google.com
gridphilly.com MX 3600 Priority: 20
Target: alt1.aspmx.l.google.com
gridphilly.com MX 3600 Priority: 20
Target: alt2.aspmx.l.google.com

Similarly Ranked Websites

SILVER | SEABORNE - Seaborne Airlines

- seaborneairlines.com
1,528,852 $ 720.00

Красная Книга Архнадзора

- redbook.archnadzor.ru

Красная Книга Москвы – здания под угрозой

1,528,852 $ 720.00

Чёрная Книга

- blackbook.archnadzor.ru

Чёрная книга АрхНадзора: московские утраты новейшей эпохи

1,528,852 $ 720.00

Ñàìûé áûñòðûé òîððåíò òðåêåð ñ íîâèíêàìè ôèëüìîâ è ñåðèàëîâ Octopus

- octopusfilm.online

Ñàìûé áûñòðûé òîððåíò òðåêåð ñ íîâèíêàìè ôèëüìîâ è ñåðèàëîâ 2018 2019 ãîäà, êîòîðûå ìîæíî ñêà÷àòü èëè ñìîòðåòü îíëàéí â õîðîøåì êà÷åñòâå HD íà Octopus

1,528,852 $ 720.00

Index of /

- onlinemarketingreviewsandtips.com
1,528,854 $ 480.00

Full WHOIS Lookup

Domain Name: GRIDPHILLY.COM
Registry Domain ID: 1412090123_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2019-03-01T21:53:32Z
Creation Date: 2008-02-29T17:19:47Z
Registrar Registration Expiration Date: 2020-02-28T17:19:47Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: abuse@godaddy.com
Registrar Abuse Contact Phone: +1.4806242505
Domain Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited http://www.icann.org/epp#clientUpdateProhibited
Domain Status: clientRenewProhibited http://www.icann.org/epp#clientRenewProhibited
Domain Status: clientDeleteProhibited http://www.icann.org/epp#clientDeleteProhibited
Registrant Organization: Red Flag Media, Inc.
Registrant State/Province: Pennsylvania
Registrant Country: US
Registrant Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=GRIDPHILLY.COM
Admin Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=GRIDPHILLY.COM
Tech Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=GRIDPHILLY.COM
Name Server: NS51.DOMAINCONTROL.COM
Name Server: NS52.DOMAINCONTROL.COM
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2019-12-13T01:00:00Z <<<

For more information on Whois status codes, please visit https://www.icann.org/resources/pages/epp-status-codes-2014-06-16-en

Notes:

IMPORTANT: Port43 will provide the ICANN-required minimum data set per
ICANN Temporary Specification, adopted 17 May 2018.
Visit https://whois.godaddy.com to look up contact data for domains
not covered by GDPR policy.

The data contained in GoDaddy.com, LLC's WhoIs database,
while believed by the company to be reliable, is provided "as is"
with no guarantee or warranties regarding its accuracy. This
information is provided for the sole purpose of assisting you
in obtaining information about domain name registration records.
Any use of this data for any other purpose is expressly forbidden without the prior written
permission of GoDaddy.com, LLC. By submitting an inquiry,
you agree to these terms of usage and limitations of warranty. In particular,
you agree not to use this data to allow, enable, or otherwise make possible,
dissemination or collection of this data, in part or in its entirety, for any
purpose, such as the transmission of unsolicited advertising and
and solicitations of any kind, including spam. You further agree
not to use this data to enable high volume, automated or robotic electronic
processes designed to collect or compile this data for any purpose,
including mining this data for your own personal or commercial purposes.

Please note: the registrant of the domain name is specified
in the "registrant" section. In most cases, GoDaddy.com, LLC
is not the registrant of domain names listed in this database.